Condividi:        

FOLDING@HOME ::: risultati WU persi!!!!

Discussioni e opinioni costruttive sul mondo dell'informatica.
Per la soluzione di problemi specifici fare riferimento alle sezioni di assistenza!

Moderatori: aurelio37, Anthony47, axelrox

FOLDING@HOME ::: risultati WU persi!!!!

Postdi Ordine » 04/04/03 00:51

Allora salve a tutti!!!
Come forse avrete letto dal titolo del TOPIC ho perso i risultati dell'ultima proteina elaborata ,una proteina da 6000 frames.....fate voi che incazzatura!!! :aaah
Allora vi dico per filo e per segno quello che è successo...il Folding@ client mi avverte di aver finito di elaborare la proteina..io felicissimo di ciò visto che erano giorni che il pc ci lavorava sopra decido di collegarmi ad internet per fargli inviare i dati.
IL pc si collega e mi compare la notifica della disponibilità del nuovo core 0.65 del Folding,sicchè non so cosa sia successo ha attaccato a scaricare l'aggiornamento e la nuovo proteina,io tutto felice che avesse anche spedito i dati vado a vedere i log e mi accorgo che forse il programma non aveva spedito proprio niente ma anzi i tanto sudati dati della proteina da 6000 sono andati in fumo..ore ed ore di computazione saltati per aria!!!! :cry:
Ora mi chiedo come c***o è possibilie ciò?
E' possibile che il lavoro di giorni vada tutto a puttane in questa maniera?
Ora di seguito vi posto i log del mio Folding client di modo che possiate magari capire meglio da quelli e mi sappiate,spero,dare una risposta!!!!
Bene eccovi i log,per lo meno quelli del giorno a cui si riferisce il fattaccio(ieri mattina e pomeriggio),nell'USER ID ho messo io gli asterischi per motivi di sicurezza miei:

# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[20:14:17] - Ask before connecting: Yes
[20:14:17] - User name: AIRDS_Ordine_e_Disciplina (Team 10078)
[20:14:17] - User ID = ***********
[20:14:17] - Machine ID: 1
[20:14:17]
[20:14:17] Loaded queue successfully.
[20:14:17] Initialization complete
[20:14:17] + Benchmarking ...
[20:14:20]
[20:14:20] + Processing work unit
[20:14:20] Core required: FahCore_ca.exe
[20:14:20] Core found.
[20:14:20] Working on Unit 01 [March 27 20:14:20]
[20:14:20] + Working ...
[20:14:22] Folding@home Protein Design Core Version 2.05 (Feb 4, 2003)
[20:14:22]
[20:14:22] Proj: work/wudata_01
[20:14:22] Finding work files
[20:14:22] sizeof(CORE_PACKET_HDR) = 512
[20:14:22] Checking frame files
[20:14:24] Restarting from checkpointed files.
[20:14:24]
[20:14:24] Protein: Des2/pdb1h97.18.spa
[20:14:24] - Frames Completed: 5200, Remaining: 800
[20:14:24] - Dynamic steps required: 160000
[20:14:24]
[20:14:24] Printed current.prm
[20:14:24] Writing local files:
[20:14:24] - Writing "work/wudata_01.key": (overwrite)successful.
[20:14:24] - Writing "work/wudata_01.xyz": (overwrite)successful.
[20:14:25] - Writing "work/wudata_01.prm": (overwrite)successful.
[20:14:25] Starting design engine
[20:14:25] [SPG] project name: work/wudata_01.
[20:14:25] [SPG] 2 11
[20:14:25] [SPG] Initializing protein design engine
[20:14:25] [SPG] seed = 9535197
[20:14:25] [SPG] Initialization complete
[20:14:25] [SPG] Writing current.pdb, chainlength = 147
[20:14:25] [SPG] Writing current.xyz
[20:14:25] [SPG] Preprocessing . . .
[20:14:25] [SPG] 147 positions in protein
[20:18:10] [SPG] Preprocessing complete
[20:18:10] Iterations: 5200 of 6000
[20:18:11] Finished
[20:18:17] [SPG] Native chi angles stored
[20:18:19] [SPG] Rotamers read
[20:18:19] [SPG] Starting genetic algorithm
[20:22:07] [SPG] seed: 257450319
[20:22:07] [SPG] Designing protein sequence 27 of 30
[20:32:14] [SPG] 10.0
[20:41:44] [SPG] 20.0
[20:50:52] [SPG] 30.0
[21:00:08] [SPG] 40.0
[21:08:36] Opening "C:\Programmi\Internet Explorer\iexplore.exe" -nohome http://folding.stanford.edu/cgi-bin/teampage?q=10078 http://folding.stanford.edu/cgi-bin/teampage?q=10078
[21:09:19] [SPG] 50.0
[21:18:07] [SPG] 60.0
[21:26:43] [SPG] 70.0
[21:35:06] [SPG] 80.0
[21:43:28] [SPG] 90.0
[21:51:45] [SPG] 100.0
[21:51:45] [SPG] Writing current.xyz
[21:51:46] [SPG] Sequence 27 completed:
[21:51:46] SITTEYASILKKKLSAKLKSTKNIVELGKRFIRQLFEKMASKTDKWHQLN . . .
[21:51:48] Iterations: 5400 of 6000
[21:51:49] Finished
[21:51:51] [SPG] seed: 266985516
[21:51:51] [SPG] Designing protein sequence 28 of 30
[22:02:25] [SPG] 10.0
[22:12:32] [SPG] 20.0
[22:21:53] [SPG] 30.0
[22:31:05] [SPG] 40.0
[22:40:15] [SPG] 50.0
[22:48:49] [SPG] 60.0
[22:56:43] [SPG] 70.0
[23:04:34] [SPG] 80.0
[23:12:31] [SPG] 90.0
[23:20:22] [SPG] 100.0
[23:20:22] [SPG] Writing current.xyz
[23:20:23] [SPG] Sequence 28 completed:
[23:20:23] VLESZDVRRLLVTLRNKMSNSQLIMQYGEELMRKIYSJLPQVVEKVKNMK . . .
[23:20:25] Iterations: 5600 of 6000
[23:20:26] Finished
[23:20:27] [SPG] seed: 276520713
[23:20:27] [SPG] Designing protein sequence 29 of 30
[23:29:44] [SPG] 10.0
[23:38:41] [SPG] 20.0
[23:47:41] [SPG] 30.0
[23:56:37] [SPG] 40.0
[00:05:27] [SPG] 50.0
[00:14:05] [SPG] 60.0
[00:22:34] [SPG] 70.0
[00:30:59] [SPG] 80.0
[00:39:18] [SPG] 90.0
[00:47:39] [SPG] 100.0
[00:47:39] [SPG] Writing current.xyz
[00:47:39] [SPG] Sequence 29 completed:
[00:47:39] VLTSEKESRYLKTFEKKIKSSEDRREFGRKMYEQMFKRKNTKVNYYNQLQ . . .
[00:47:40] Iterations: 5800 of 6000
[00:47:41] Finished
[00:47:42] [SPG] seed: 286055910
[00:47:42] [SPG] Designing protein sequence 30 of 30
[00:57:00] [SPG] 10.0
[01:06:04] [SPG] 20.0
[01:14:56] [SPG] 30.0
[01:23:39] [SPG] 40.0
[01:32:08] [SPG] 50.0
[01:40:23] [SPG] 60.0
[01:48:32] [SPG] 70.0
[01:56:42] [SPG] 80.0
[02:04:34] [SPG] 90.0
[02:12:19] [SPG] 100.0
[02:12:19] [SPG] Writing current.xyz
[02:12:19] [SPG] Sequence 30 completed:
[02:12:19] ALQKEIQKLLKRRLQSWIADSSYKKSLGKYLIRRLLRSYRYLIEFKTVMT . . .
[02:12:20] Iterations: 6000 of 6000
[02:12:21] Finished
[02:12:22] [SPG] Design complete
[02:12:23] [SPG] completed successfully
[02:12:23]
[02:12:23] Finished Work Unit
[02:12:23] work_hdr.len_arcfile: 242550
[02:12:24] Leaving Run
[02:12:26] - Writing 243062 bytes of core data to disk.
[02:12:26] end (WriteWorkResults)
[02:12:26] - Shutting down core
[02:12:26]
[02:12:26] Folding@Home2 Protein Design Core Shutdown: FINISHED_UNIT
[02:12:30] CoreStatus = 64 (100)
[02:12:30] Sending work to server


[02:12:30] + Attempting to send results


--- Opening Log file [March 28 07:20:34]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[07:20:34] - Ask before connecting: Yes
[07:20:34] - User name: AIRDS_Ordine_e_Disciplina (Team 10078)
[07:20:34] - User ID = *************
[07:20:34] - Machine ID: 1
[07:20:34]
[07:20:34] Loaded queue successfully.
[07:20:34] Initialization complete
[07:20:34] + Benchmarking ...
[07:20:37] + Attempting to get work packet
[07:22:27] - Connecting to assignment server
[07:22:36] - Successful: assigned to (171.64.122.143).
[07:22:36] + News From Folding@Home: Welcome to Folding@Home
[07:22:36] Loaded queue successfully.
[07:22:43] - Deadline time not received.
[07:23:09] + Connections closed: You may now disconnect
[07:23:09]
[07:23:09] + Processing work unit
[07:23:09] Core required: FahCore_65.exe
[07:23:09] Core not found.
[07:23:09] - Core is not present or corrupted.
[07:23:09] - Attempting to download new core...
[07:23:09] + Downloading new core: FahCore_65.exe
[07:26:08] Opening "C:\Programmi\Internet Explorer\iexplore.exe" -nohome C:\Programmi\Folding@Home\MyFolding.html C:\Programmi\Folding@Home\MyFolding.html

Folding@home Client Shutdown.


--- Opening Log file [March 28 07:28:25]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[07:28:25] - Ask before connecting: Yes
[07:28:25] - User name: AIRDS_Ordine_e_Disciplina (Team 10078)
[07:28:25] - User ID = **********
[07:28:25] - Machine ID: 1
[07:28:25]
[07:28:25] Loaded queue successfully.
[07:28:25] Initialization complete
[07:28:25] + Benchmarking ...
[07:28:28]
[07:28:28] + Processing work unit
[07:28:28] Core required: FahCore_65.exe
[07:28:28] Core not found.
[07:28:28] - Core is not present or corrupted.
[07:28:28] - Attempting to download new core...
[07:28:28] + Downloading new core: FahCore_65.exe


--- Opening Log file [March 28 18:32:18]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[18:32:18] - Ask before connecting: Yes
[18:32:18] - User name: AIRDS_Ordine_e_Disciplina (Team 10078)
[18:32:18] - User ID = ************
[18:32:18] - Machine ID: 1
[18:32:18]
[18:32:18] Loaded queue successfully.
[18:32:18] Initialization complete
[18:32:18] + Benchmarking ...
[18:32:21]
[18:32:21] + Processing work unit
[18:32:21] Core required: FahCore_65.exe
[18:32:21] Core not found.
[18:32:21] - Core is not present or corrupted.
[18:32:21] - Attempting to download new core...
[18:32:21] + Downloading new core: FahCore_65.exe
[18:32:31] + 10240 bytes downloaded
[18:32:32] + 20480 bytes downloaded
[18:32:32] + 30720 bytes downloaded
[18:32:32] + 40960 bytes downloaded
[18:32:32] + 51200 bytes downloaded
[18:32:33] + 61440 bytes downloaded
[18:32:34] + 71680 bytes downloaded
[18:32:34] + 81920 bytes downloaded
[18:32:34] + 92160 bytes downloaded
[18:32:34] + 102400 bytes downloaded
[18:32:35] + 112640 bytes downloaded
[18:32:35] + 122880 bytes downloaded
[18:32:35] + 133120 bytes downloaded
[18:32:36] + 143360 bytes downloaded
[18:32:36] + 153600 bytes downloaded
[18:32:36] + 163840 bytes downloaded
[18:32:37] + 174080 bytes downloaded
[18:32:37] + 184320 bytes downloaded
[18:32:37] + 194560 bytes downloaded
[18:32:38] + 204800 bytes downloaded
[18:32:38] + 215040 bytes downloaded
[18:32:38] + 225280 bytes downloaded
[18:32:39] + 235520 bytes downloaded
[18:32:39] + 245760 bytes downloaded
[18:32:39] + 256000 bytes downloaded
[18:32:40] + 266240 bytes downloaded
[18:32:40] + 276480 bytes downloaded
[18:32:40] + 286720 bytes downloaded
[18:32:41] + 296960 bytes downloaded
[18:32:41] + 307200 bytes downloaded
[18:32:41] + 317440 bytes downloaded
[18:32:42] + 327680 bytes downloaded
[18:32:42] + 337920 bytes downloaded
[18:32:42] + 348160 bytes downloaded
[18:32:43] + 358400 bytes downloaded
[18:32:43] + 368640 bytes downloaded
[18:32:43] + 378880 bytes downloaded
[18:32:44] + 389120 bytes downloaded
[18:32:44] + 399360 bytes downloaded
[18:32:44] + 409600 bytes downloaded
[18:32:45] + 419840 bytes downloaded
[18:32:45] + 430080 bytes downloaded
[18:32:45] + 440320 bytes downloaded
[18:32:46] + 450560 bytes downloaded
[18:32:46] + 460800 bytes downloaded
[18:32:46] + 471040 bytes downloaded
[18:32:47] + 481280 bytes downloaded
[18:32:47] + 491520 bytes downloaded
[18:32:47] + 501760 bytes downloaded
[18:32:48] + 512000 bytes downloaded
[18:32:48] + 522240 bytes downloaded
[18:32:48] + 532480 bytes downloaded
[18:32:49] + 542720 bytes downloaded
[18:32:49] + 552960 bytes downloaded
[18:32:49] + 563200 bytes downloaded
[18:32:50] + 573440 bytes downloaded
[18:32:50] + 583680 bytes downloaded
[18:32:50] + 592641 bytes downloaded
[18:32:50] Verifying core Core_65.fah...
[18:32:50] Signature is VALID
[18:32:50] Created: Wednesday April 10, 2002 00:01:22 UTC
[18:32:50] Signed: Friday June 14, 2002 00:00:16 UTC
[18:32:50]
[18:32:50] Trying to unzip core FahCore_65.exe
[18:32:51] Decompressed FahCore_65.exe (1732608 bytes) successfully
[18:32:51] + Core successfully engaged
[18:32:56]
[18:32:56] + Processing work unit
[18:32:56] Core required: FahCore_65.exe
[18:32:56] Core found.
[18:32:56] Working on Unit 02 [March 28 18:32:56]
[18:32:56] + Working ...
[18:32:56] Folding@Home Client Core Version 2.47 (June 14, 2002)
[18:32:56]
[18:32:56] Proj: work/wudata_02
[18:32:57] nsteps: 5000000 dt: 2.000000 dt_dump: 250.000000 temperature: 296.000000
[18:32:57] xyzfile:
[18:32:57] " 227 P652_TZ3_NAT_LOWVISC
[18:32:57] 1 N3 -3.135856 9.615979 1.015633 1..."
[18:32:57] keyfile:
[18:32:57] "parameters ./proj652.prm
[18:32:57] NOVERSION
[18:32:57] ARCHIVE
[18:32:57]
[18:32:57] printout 1000
[18:32:57] writeout ..."
[18:32:57]
[18:32:57] - Couldn't get size info for dyn file: work/wudata_02.dyn
[18:32:57] Starting from initial work packet
[18:32:57]
[18:32:57] Protein: P652_TZ3_NAT_LOWVISC
[18:32:57] - Run: 3 (Clone 70, Gen 0)
[18:32:57] - Frames Completed: 0, Remaining: 400
[18:32:57] - Dynamic steps required: 5000000
[18:32:57]
[18:32:57] Writing local files:
[18:32:57]
[18:32:57] parameters work/wudata_02.prm
[18:32:57] - Writing "work/wudata_02.key": (overwrite) successful.
[18:32:57] - Writing "work/wudata_02.xyz": (overwrite) successful.
[18:32:57] - Writing "work/wudata_02.prm": (overwrite) successful.
[18:32:58] - Writing "work/wudata_02.key": (append) successful.
[18:32:58]
[18:32:58] PROJECT="work/wudata_02", NSTEPS=5000000, DT=2.0000, DTDUMP=25.000000, TEMP=296.00
[18:32:58] TINKER: Software Tools for Molecular Design
[18:32:58] Version 3.8 October 2000
[18:32:58] Copyright (c) Jay William Ponder 1990-2000
[18:32:58] portions Copyright (c) Michael Shirts 2001
[18:32:58] portions Copyright (c) Vijay S Pande 2001
[18:34:39] Opening "C:\Programmi\Internet Explorer\iexplore.exe" -nohome http://folding.stanford.edu/cgi-bin/use ... Disciplina http://folding.stanford.edu/cgi-bin/use ... Disciplina
[18:35:14] Opening "C:\Programmi\Internet Explorer\iexplore.exe" -nohome http://folding.stanford.edu/cgi-bin/teampage?q=10078 http://folding.stanford.edu/cgi-bin/teampage?q=10078
[18:38:29] Finished a frame (1)
[18:43:46] Finished a frame (2)
[18:49:02] Finished a frame (3)
[18:54:17] Finished a frame (4)
[18:59:39] Finished a frame (5)
[19:05:05] Finished a frame (6)
[19:10:44] Finished a frame (7)
[19:12:21] + Paused
[19:12:22] Suspending work thread...

Folding@home Client Shutdown.



Pensavate fosse tutto qui ed invece no perchè dopo quella da 600 frames ho perso anche i risultati di una WU da 400 frames :aaah
c**o adesso è davvero troppo non è possibile far passare il pc ad elaborare ore ed ore per perdere tutti i dati!!!! :aaah
Vi incollo il log del programma dimodo che possiate leggere che c**o combina e semmai indircarmi una via di uscita a sta c**o di cosa che mi sta facendo imbestialire non poco!!! :aaah
Eccoil log....ho copiato la parte dilog da poco prima che succedesse il fattaccio fino a poco fa:

..............................................................
[00:29:30] Finished a frame (384)
[00:34:46] Finished a frame (385)
[00:40:02] Finished a frame (386)
[00:45:18] Finished a frame (387)
[00:50:33] Finished a frame (388)
[00:55:48] Finished a frame (389)
[01:01:04] Finished a frame (390)
[01:06:20] Finished a frame (391)
[01:11:36] Finished a frame (392)
[01:16:52] Finished a frame (393)
[01:22:07] Finished a frame (394)
[01:27:23] Finished a frame (395)
[01:32:38] Finished a frame (396)
[01:37:54] Finished a frame (397)
[01:43:09] Finished a frame (398)
[01:48:25] Finished a frame (399)
[01:53:40] Finished a frame (400)
[01:53:40] TINKER is Exiting following Normal Termination
[01:53:40]
[01:53:40] Finished Work Unit:
[01:53:47] ARC file integrity verified
[01:53:48] logfile size: 20480
[01:53:48] Leaving Run
[01:53:49] - Writing 628984 bytes of core data to disk.
[01:53:49] end (WriteWorkResults)
[01:53:49] - Shutting down core
[01:53:49]
[01:53:49] Folding@Home2 Core Shutdown: FINISHED_UNIT
[01:53:52] CoreStatus = 64 (100)
[01:53:52] Sending work to server


[01:53:53] + Attempting to send results


--- Opening Log file [April 3 06:09:06]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[06:09:06] - Ask before connecting: Yes
[06:09:06] - User name: AIRDS_Ordine_e_Disciplina (Team 10078)
[06:09:06] - User ID = ***************
[06:09:06] - Machine ID: 1
[06:09:06]
[06:09:07] Loaded queue successfully.
[06:09:07] Initialization complete
[06:09:07] + Benchmarking ...
[06:09:10] + Attempting to get work packet
[06:10:02] - Connecting to assignment server
[06:10:16] - Successful: assigned to (171.64.122.125).
[06:10:16] + News From Folding@Home: Welcome to Folding@Home
[06:10:16] Loaded queue successfully.
[06:10:23] - Deadline time not received.
[06:10:40] + Connections closed: You may now disconnect
[06:10:40]
[06:10:40] + Processing work unit
[06:10:40] Core required: FahCore_ca.exe
[06:10:40] Core found.
[06:10:40] Working on Unit 03 [April 3 06:10:40]
[06:10:40] + Working ...
[06:10:40] Folding@home Protein Design Core Version 2.05 (Feb 4, 2003)
[06:10:40]
[06:10:40] Proj: work/wudata_03
[06:10:40] Finding work files
[06:10:40] sizeof(CORE_PACKET_HDR) = 512
[06:10:40] Error: Work unit read from disk is invalid
[06:10:40]
[06:10:40] Folding@Home2 Protein Design Core Shutdown: CORE_OUTDATED
[06:10:44] CoreStatus = 6E (110)
[06:10:44] + Core out of date. Auto updating...
[06:10:44] - Attempting to download new core...
[06:10:44] + Downloading new core: FahCore_ca.exe
[06:13:05] + 140 bytes downloaded
[06:13:05] Verifying core Core_ca.fah...
[06:13:05] Could not read compressed core for verification.
[06:13:05] Failed to verify core
[06:13:05] + Error: Could not extract core
[06:13:05] + Core download error (#2), waiting before retry...

[06:13:10] + Downloading new core: FahCore_ca.exe

Folding@home Client Shutdown.


--- Opening Log file [April 3 06:14:03]


# Windows Graphical Edition ###################################################
###############################################################################

Folding@home Client Version 3.24

http://foldingathome.stanford.edu
email:help@foldingathome.stanford.edu

###############################################################################
###############################################################################



[06:14:03] - Ask before connecting: Yes
[06:14:03] - User name: AIRDS_Ordine_e_Disciplina (Team 10078)
[06:14:03] - User ID = ***************
[06:14:03] - Machine ID: 1
[06:14:03]
[06:14:03] Loaded queue successfully.
[06:14:03] Initialization complete
[06:14:03] + Benchmarking ...
[06:14:06]
[06:14:06] + Processing work unit
[06:14:06] Core required: FahCore_ca.exe
[06:14:06] Core found.
[06:14:06] Working on Unit 03 [April 3 06:14:06]
[06:14:06] + Working ...
[06:14:06] Folding@home Protein Design Core Version 2.05 (Feb 4, 2003)
[06:14:06]
[06:14:06] Proj: work/wudata_03
[06:14:06] Finding work files
[06:14:06] sizeof(CORE_PACKET_HDR) = 512
[06:14:06] Error: Work unit read from disk is invalid
[06:14:06]
[06:14:06] Folding@Home2 Protein Design Core Shutdown: CORE_OUTDATED
[06:14:11] CoreStatus = 6E (110)
[06:14:11] + Core out of date. Auto updating...
[06:14:11] - Attempting to download new core...
[06:14:11] + Downloading new core: FahCore_ca.exe
[06:14:24] + 10240 bytes downloaded
[06:14:27] + 20480 bytes downloaded
[06:14:30] + 30720 bytes downloaded
[06:14:32] + 40960 bytes downloaded
[06:14:40] + 51200 bytes downloaded
[06:14:41] + 61440 bytes downloaded
[06:14:41] + 71680 bytes downloaded
[06:14:43] + 81920 bytes downloaded
[06:14:45] + 92160 bytes downloaded
[06:14:48] + 102400 bytes downloaded
[06:14:50] + 112640 bytes downloaded
[06:14:53] + 122880 bytes downloaded
[06:14:56] + 133120 bytes downloaded
[06:14:58] + 143360 bytes downloaded
[06:15:01] + 153600 bytes downloaded
[06:15:04] + 163840 bytes downloaded
[06:15:06] + 174080 bytes downloaded
[06:15:09] + 184320 bytes downloaded
[06:15:16] + 194560 bytes downloaded
[06:15:16] + 204800 bytes downloaded
[06:15:17] + 215040 bytes downloaded
[06:15:19] + 225280 bytes downloaded
[06:15:22] + 235520 bytes downloaded
[06:15:25] + 245760 bytes downloaded
[06:15:27] + 256000 bytes downloaded
[06:15:30] + 266240 bytes downloaded
[06:15:33] + 276480 bytes downloaded
[06:15:35] + 286720 bytes downloaded
[06:15:38] + 296960 bytes downloaded
[06:15:41] + 307200 bytes downloaded
[06:15:43] + 317440 bytes downloaded
[06:15:46] + 327680 bytes downloaded
[06:15:49] + 337920 bytes downloaded
[06:15:52] + 348160 bytes downloaded
[06:15:55] + 358400 bytes downloaded
[06:15:57] + 368640 bytes downloaded
[06:15:59] + 378880 bytes downloaded
[06:16:02] + 389120 bytes downloaded
[06:16:05] + 399360 bytes downloaded
[06:16:07] + 409600 bytes downloaded
[06:16:10] + 419840 bytes downloaded
[06:16:12] + 430080 bytes downloaded
[06:16:15] + 440320 bytes downloaded
[06:16:18] + 450560 bytes downloaded
[06:16:21] + 460800 bytes downloaded
[06:16:26] + 471040 bytes downloaded
[06:16:26] + 480026 bytes downloaded
[06:16:26] Verifying core Core_ca.fah...
[06:16:26] Signature is VALID
[06:16:26] Created: Wednesday April 10, 2002 00:01:22 UTC
[06:16:26] Signed: Monday March 3, 2003 00:18:15 UTC
[06:16:26]
[06:16:26] Trying to unzip core FahCore_ca.exe
[06:16:27] Decompressed FahCore_ca.exe (1466368 bytes) successfully
[06:16:27] + Core successfully engaged
[06:16:32]
[06:16:32] + Processing work unit
[06:16:32] Core required: FahCore_ca.exe
[06:16:32] Core found.
[06:16:32] Working on Unit 03 [April 3 06:16:32]
[06:16:32] + Working ...
[06:16:33] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[06:16:33]
[06:16:33] Proj: work/wudata_03
[06:16:33] Finding work files
[06:16:33] sizeof(CORE_PACKET_HDR) = 512
[06:16:33] Checking frame files
[06:16:33] - Couldn't open work/wudata_03.chk
[06:16:33] Starting from initial work packet
[06:16:33]
[06:16:33] Updating shared core-client information
[06:16:33] - Writing "work/wudata_03.key": (overwrite)successful.
[06:16:33] Key file to update shared file: work/wudata_03.key
[06:16:33] keyfile: 0 113 200 15 2 1 0
[06:16:33] Protein: LIF/pdblif1.34.xyz
[06:16:33] - Frames Completed: 0, Remaining: 600
[06:16:33] - Dynamic steps required: 120000
[06:16:33]
[06:16:34] Printed current.prm
[06:16:34] Writing local files:
[06:16:34] - Writing "work/wudata_03.key": (overwrite)successful.
[06:16:34] - Writing "work/wudata_03.xyz": (overwrite)successful.
[06:16:34] - Writing "work/wudata_03.prm": (overwrite)successful.
[06:16:34] Starting design engine
[06:16:34] [SPG] project name: work/wudata_03.
[06:16:34] [SPG] 1 0
[06:16:34] [SPG] Initializing protein design engine
[06:16:34] [SPG] seed = 0
[06:16:34] [SPG] Initialization complete
[06:16:34] [SPG] Writing current.pdb, chainlength = 113
[06:16:35] [SPG] Writing current.xyz
[06:16:35] [SPG] Preprocessing . . .
[06:16:35] [SPG] 113 positions in protein
[06:18:41] [SPG] Preprocessing complete
[06:18:41] Iterations: 0 of 600
[06:18:42] Finished
[06:18:42] [SPG] Native chi angles stored
[06:18:43] [SPG] Rotamers read
[06:18:43] [SPG] Starting genetic algorithm
[06:18:57] [SPG] seed: 12993594
[06:18:57] [SPG] Designing protein sequence 1 of 30
[06:20:26] Opening "C:\Programmi\Internet Explorer\iexplore.exe" -nohome http://folding.stanford.edu/cgi-bin/use ... Disciplina http://folding.stanford.edu/cgi-bin/use ... Disciplina
[06:20:54] Opening "C:\Programmi\Internet Explorer\iexplore.exe" -nohome http://folding.stanford.edu/cgi-bin/teampage?q=10078 http://folding.stanford.edu/cgi-bin/teampage?q=10078
[06:23:34] [SPG] 10.0
[06:27:49] [SPG] 20.0
[06:31:53] [SPG] 30.0
[06:35:53] [SPG] 40.0
[06:39:57] [SPG] 50.0
[06:44:02] [SPG] 60.0
[06:48:08] [SPG] 70.0
[06:52:13] [SPG] 80.0
[06:56:18] [SPG] 90.0
[07:00:22] [SPG] 100.0
[07:00:22] [SPG] Writing current.xyz
[07:00:22] [SPG] Sequence 1 completed:

...................................



Ma dico è possibile perdere i dati in questo modo?
Soprattutto ho notato che il problema si verifica perchè tutte le volte il programma cerca di scaricare un nuovo core..ma a che serve sto core tutte le volte..la volta scorsa il core 0.65 ora il core _ca.. ma a che servono vorrei sapere che mi fanno saltare il tutto!!!! :(
Vabbè spero che mi riusciate a dare una risposta perchè sono veramente spazientito e non intendo continuare in sto modo..al progetto ci tengo moltissimo..ma possibile che tutte le volte devo perdere i dati!!! :(
Ho già perso 3 WU di cui due da 400 frames ed una da 6000 fate voi..se non devo essere inc***ato nero!!! :aaah
Bene scusate ancora per lo sfogo ma non so a chi scrivere altrimenti.
bene apetto con ansia vostre risposte ;)
Ciao Ciao
Ordine :diavolo:
Traduzione Giochi ITA di American McGee's Alice, SOF 1, Hexen 2, Nosferatu e Star Trek Elite Force 2!!!
Immagine
Ordine
Utente Senior
 
Post: 260
Iscritto il: 14/07/02 22:59
Località: Cian De San Roccu!!!

Sponsor
 

Postdi Ordine » 04/04/03 18:45

allora vedo che brancolate ne buoi come sto facendo io ..o perlomeno ora non più dopo che ho ricevuto la risposta sui due forum principali del Folding@Home Projects....siccome penso che possa essere utile a molti posto qui sotto i links dei post con le risposte sui suddetti 2 forum!!!! :P

Link sul sito degli AIRSD di cui faccio parte:

http://forum.airsd.org/viewtopic.php?t=801

Link sul sito mondiale del Folding@Home Projects:

http://forum.folding-community.org/view ... 1341#31341

Ciao a tutti speroche questo vi sia utile :P
A presto :P
Ciao Ciao
Ordine :diavolo:
Traduzione Giochi ITA di American McGee's Alice, SOF 1, Hexen 2, Nosferatu e Star Trek Elite Force 2!!!
Immagine
Ordine
Utente Senior
 
Post: 260
Iscritto il: 14/07/02 22:59
Località: Cian De San Roccu!!!

Postdi Frengo78 » 04/04/03 19:29

Ma ora hai risolto Ordine? la terza WU è andata?
Knowledge is a weapon
Frengo78
Utente Senior
 
Post: 8985
Iscritto il: 16/07/02 08:41
Località: Torino

Postdi BianConiglio » 04/04/03 19:51

sisis ha risolto :D
BianConiglio
Utente Senior
 
Post: 4710
Iscritto il: 26/12/01 01:00
Località: Varese / Lugano

Postdi Ordine » 04/04/03 20:12

Beh insomma risolto..per ora mi hanno detto che non ho perso i risultati..in realtà sembra che il risultato della Wu da 6000 frames sia stato uplodato ma non compare negli stats e quindi il site administrator del Forum Folding sta chiedendo a quelli di Stanford dove siano finiti i risultati della Wu!!!
Se volete leggere con i vostri occhi leggete qui di seguito:

http://forum.folding-community.org/viewtopic.php?t=4040

Beh speriamo si risolva nel migliore dei modi :(
Ciao a tutti vi terrò informati :P
Grazie per l'interessamento :P
Ordine :diavolo:
Traduzione Giochi ITA di American McGee's Alice, SOF 1, Hexen 2, Nosferatu e Star Trek Elite Force 2!!!
Immagine
Ordine
Utente Senior
 
Post: 260
Iscritto il: 14/07/02 22:59
Località: Cian De San Roccu!!!


Torna a Discussioni


Topic correlati a "FOLDING@HOME ::: risultati WU persi!!!!":


Chi c’è in linea

Visitano il forum: Nessuno e 59 ospiti